ABclonal

Alpha-Fetoprotein (AFP) Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name Alpha-Fetoprotein (AFP) Rabbit pAb
Catalog No. AB-A11013
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-609 of human Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) (NP_001125.1).
Sequence RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Gene ID 174
Swiss prot P02771
Synonyms AFPD; FETA; HPAFP; AFP
Calculated MW 68kDa
Observed MW 68kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:500 - 1:2000
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver
Cellular location Secreted
ABclonal:Western blot - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013) }

Western blot - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013)

Western blot analysis of extracts of mouse liver, using Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) antibody (A11013) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013) }

Immunofluorescence - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013)

Immunofluorescence analysis of human liver cancer using Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) antibody (A11013) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013) }

Immunofluorescence - Alpha-Fetoprotein (AFP) Rabbit pAb (A11013)

Immunofluorescence analysis of HepG2 cells (upper left) and LO2 cells (negative sample control) (upper right) using Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) Rabbit pAb (red, A11013) at dilution of 1:100. Blue: DAPI for nuclear staining.
[ndnapps-contactform]