ABclonal

ACTR3 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ACTR3 Rabbit pAb
Catalog No. AB-A1064
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-418 of human ACTR3 (NP_005712.1).
Sequence MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Gene ID 10096
Swiss prot P61158
Synonyms ACTR3; ARP3
Calculated MW 47kDa
Observed MW 47kDa
Reactivity Human, Mouse, Rat, Monkey
Tested applications WB IF
Recommended dilution WB 1:500 - 1:2000
IF 1:10 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples K-562, HL-60, HeLa, Jurkat, COS-1, COS-7, Mouse spleen
Cellular location Cell projection, Cytoplasm, cytoskeleton
ABclonal:Western blot - ACTR3 Polyclonal Antibody (A1064) }

Western blot - ACTR3 Polyclonal Antibody (A1064)

Western blot analysis of extracts of various cell lines, using ACTR3 antibody (A1064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunofluorescence - ACTR3 Polyclonal Antibody (A1064) }

Immunofluorescence - ACTR3 Polyclonal Antibody (A1064)

Immunofluorescence analysis of HeLa cells using ACTR3 antibody (A1064). Blue: DAPI for nuclear staining.


[ndnapps-contactform]