ABclonal

AP1S1 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name AP1S1 Rabbit pAb
Catalog No. AB-A10558
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1).
Sequence MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
Gene ID 1174
Swiss prot P61966
Synonyms AP1S1; AP19; CLAPS1; EKV3; MEDNIK; SIGMA1A
Calculated MW 16kDa/18kDa
Observed MW 19kDa
Reactivity Human
Tested applications WB
Recommended dilution WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SW480
Cellular location Cytoplasmic side, Cytoplasmic vesicle membrane, Golgi apparatus, Membrane, Peripheral membrane protein, clathrin-coated pit
ABclonal:Western blot - AP1S1 Polyclonal Antibody (A10558) }

Western blot - AP1S1 Polyclonal Antibody (A10558)

Western blot analysis of extracts of SW480 cells, using AP1S1 antibody (A10558) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
[ndnapps-contactform]