ABclonal

ApoER2/LRP8 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ApoER2/LRP8 Rabbit pAb
Catalog No. AB-A10517
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2).
Sequence PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Gene ID 7804
Swiss prot Q14114
Synonyms LRP8; APOER2; HSZ75190; LRP-8; MCI1
Calculated MW 77kDa/87kDa/99kDa/105kDa
Observed MW 105-120kDa
Reactivity Human, Mouse, Rat
Tested applications WB IHC IF
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y, Rat testis
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
ABclonal:Western blot - ApoER2/LRP8 Rabbit pAb (A10517) }

Western blot - ApoER2/LRP8 Rabbit pAb (A10517)

Western blot analysis of extracts of various cell lines, using ApoER2/ApoER2/LRP8 antibody (A10517) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - ApoER2/LRP8 Rabbit pAb (A10517) }

Immunofluorescence - ApoER2/LRP8 Rabbit pAb (A10517)

Immunofluorescence analysis of Human placenta using ApoER2/ApoER2/LRP8 antibody (A10517) at dilution of 1:100. Blue: DAPI for nuclear staining.
[ndnapps-contactform]