ABclonal

ANO1 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ANO1 Rabbit pAb
Catalog No. AB-A10498
Host species Rabbit
Purification method Affinity purification
Isotype IgG

 

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 628-731 of human ANO1 (NP_060513.5).
Sequence FKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLEPFAGLTPEYME
Gene ID 55107
Swiss prot Q5XXA6
Synonyms ANO1; DOG1; ORAOV2; TAOS2; TMEM16A
Calculated MW 74kDa/97kDa/114kDa
Observed MW 150kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:1000 - 1:2000
IF 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HCT116, HeLa
Cellular location Cell membrane, Cytoplasm, Multi-pass membrane protein
Customer validation

WB(Rattus norvegicus)

PMID: 33311015  Title: TMEM16A Regulates Pulmonary Arterial Smooth Muscle Cells Proliferation via p38MAPK/ERK Pathway in High Pulmonary Blood Flow-Induced Pulmonary Arterial Hypertension 
ABclonal:Western blot - ANO1 Rabbit pAb (A10498) }

Western blot - ANO1 Rabbit pAb (A10498)

Western blot analysis of extracts of various cell lines, using ANO1 antibody (A10498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - ANO1 Rabbit pAb (A10498) }

Immunofluorescence - ANO1 Rabbit pAb (A10498)

Immunofluorescence analysis of U2OS cells using ANO1 antibody (A10498) at dilution of 1:100. Blue: DAPI for nuclear staining.
[ndnapps-contactform]