ABclonal

AGPS Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name AGPS Rabbit pAb
Catalog No. AB-A10484
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 379-658 of human AGPS (NP_003650.1).
Sequence IKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRLMDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDLCRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
Gene ID 8540
Swiss prot O00116
Synonyms AGPS; ADAP-S; ADAS; ADHAPS; ADPS; ALDHPSY; RCDP3
Calculated MW 72kDa
Observed MW 60-73kDa
Reactivity Human, Mouse
Tested applications WB
Recommended dilution WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HL-60, HeLa, HepG2, K-562, Mouse kidney, Mouse lung
Cellular location Peroxisome membrane
ABclonal:Western blot - AGPS Polyclonal Antibody (A10484) }

Western blot - AGPS Polyclonal Antibody (A10484)

Western blot analysis of extracts of various cell lines, using AGPS antibody (A10484) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
[ndnapps-contactform]