ABclonal

AKR1C2 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name AKR1C2 Rabbit pAb
Catalog No. AB-A1048
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1).
Sequence MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Gene ID 1646
Swiss prot P52895
Synonyms AKR1C2; AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD
Calculated MW 15kDa/36kDa
Observed MW 37kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:500 - 1:2000
IF 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HT-29, A549, Mouse liver
Cellular location Cytoplasm
ABclonal:Western blot - AKR1C2 Polyclonal Antibody (A1048) }

Western blot - AKR1C2 Polyclonal Antibody (A1048)

Western blot analysis of extracts of various cell lines, using AKR1C2 antibody (A1048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - AKR1C2 Polyclonal Antibody (A1048) }

Immunofluorescence - AKR1C2 Polyclonal Antibody (A1048)

Immunofluorescence analysis of L929 cells using AKR1C2 Polyclonal Antibody (A1048) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - AKR1C2 Polyclonal Antibody (A1048) }

Immunofluorescence - AKR1C2 Polyclonal Antibody (A1048)

Immunofluorescence analysis of U-2 OS cells using AKR1C2 Polyclonal Antibody (A1048) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
[ndnapps-contactform]