ABclonal

ARHGAP45 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ARHGAP45 Rabbit pAb
Catalog No. AB-A10454
Host species Rabbit
Purification method Affinity purification
Isotype IgG

 

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ARHGAP45 (NP_036424.2).
Sequence MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRV
Gene ID 23526
Swiss prot Q92619
Synonyms ARHGAP45; HA-1; HLA-HA1; HMHA1
Calculated MW 124kDa/126kDa
Observed MW 120kDa
Reactivity Human, Rat
Tested applications WB
Recommended dilution WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-251MG, LO2, DU145
Cellular location
ABclonal:Western blot - ARHGAP45 Polyclonal Antibody (A10454) }

Western blot - ARHGAP45 Polyclonal Antibody (A10454)

Western blot analysis of extracts of various cell lines, using ARHGAP45 antibody (A10454) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
[ndnapps-contactform]