ABclonal

ALDH3B1 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ALDH3B1 Rabbit pAb
Catalog No. AB-A10415
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the aldehyde dehydrogenase protein family. Aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The encoded protein is able to oxidize long-chain fatty aldehydes in vitro, and may play a role in protection from oxidative stress. Alternative splicing results in multiple transcript variants.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1).
Sequence MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYP
Gene ID 221
Swiss prot P43353
Synonyms ALDH3B1; ALDH4; ALDH7
Calculated MW 47kDa/51kDa
Observed MW 52kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, Mouse kidney, Mouse liver, Rat lung
Cellular location Cell membrane, Lipid-anchor
ABclonal:Western blot - ALDH3B1 Rabbit pAb (A10415) }

Western blot - ALDH3B1 Rabbit pAb (A10415)

Western blot analysis of extracts of various cell lines, using ALDH3B1 antibody (A10415) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
[ndnapps-contactform]