ABclonal

AP3M1 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name AP3M1 Rabbit pAb
Catalog No. AB-A10410
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The protein encoded by this gene is the medium subunit of AP-3, which is an adaptor-related protein complex associated with the Golgi region as well as more peripheral intracellular structures. AP-3 facilitates the budding of vesicles from the Golgi membrane, and it may directly function in protein sorting to the endosomal/lysosomal system. AP-3 is a heterotetrameric protein complex composed of two large subunits (delta and beta3), a medium subunit (mu3), and a small subunit (sigma 3). Mutations in one of the large subunits of AP-3 have been associated with the Hermansky-Pudlak syndrome, a genetic disorder characterized by defective lysosome-related organelles. Alternative splicing of this gene results in multiple transcript variants.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 219-418 of human AP3M1 (NP_036227.1).
Sequence SLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT
Gene ID 26985
Swiss prot Q9Y2T2
Synonyms AP3M1
Calculated MW 46kDa
Observed MW 47kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 22Rv1, Mouse liver, Mouse kidney, Rat spinal cord, Rat liver
Cellular location Cytoplasmic side, Cytoplasmic vesicle membrane, Golgi apparatus, Peripheral membrane protein
ABclonal:Western blot - AP3M1 Rabbit pAb (A10410) }

Western blot - AP3M1 Rabbit pAb (A10410)

Western blot analysis of extracts of various cell lines, using AP3M1 antibody (A10410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
[ndnapps-contactform]