ABclonal

AADAC Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name AADAC Rabbit pAb
Catalog No. AB-A10365
Host species Rabbit
Purification method Affinity purification
Isotype IgG


Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-399 of human AADAC (NP_001077.2).
Sequence KKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Gene ID 13
Swiss prot P22760
Synonyms AADAC; CES5A1; DAC
Calculated MW 45kDa
Observed MW 46kDa
Reactivity Human, Mouse
Tested applications WBIHC
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, Mouse liver
Cellular location Endoplasmic reticulum membrane, Microsome membrane, Single-pass type II membrane protein
ABclonal:Western blot - AADAC Rabbit pAb (A10365) }

Western blot - AADAC Rabbit pAb (A10365)

Western blot analysis of extracts of various cell lines, using AADAC antibody (A10365) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
[ndnapps-contactform]