ABclonal

ADAM19 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ADAM19 Rabbit pAb
Catalog No. AB-A10260
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has been demonstrated to be an active metalloproteinase, which may be involved in normal physiological processes such as cell migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. It is proposed to play a role in pathological processes, such as cancer, inflammatory diseases, renal diseases, and Alzheimer's disease.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 203-460 of human ADAM19 (NP_150377.1).
Sequence REDLNSMKYVELYLVADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCGNGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGS
Gene ID 8728
Swiss prot Q9H013
Synonyms ADAM19; FKSG34; MADDAM; MLTNB
Calculated MW 100kDa/104kDa
Observed MW 72kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:1000 - 1:2000
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HT-1080, SW480, NIH/3T3, Mouse heart, Mouse lung, Mouse liver, Mouse kidney, Rat heart
Cellular location Membrane, Single-pass type I membrane protein
ABclonal:Western blot - ADAM19 Rabbit pAb (A10260) }

Western blot - ADAM19 Rabbit pAb (A10260)

Western blot analysis of extracts of various cell lines, using ADAM19 antibody (A10260) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
[ndnapps-contactform]