ABclonal

4-1BBL/CD137L Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name 4-1BBL/CD137L Rabbit pAb
Catalog No. AB-A10202
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-254 of human 4-1BBL/CD137L (NP_003802.1).
Sequence VSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Gene ID 8744
Swiss prot P41273
Synonyms TNFSF9; 4-1BB-L; CD137L; TNLG5A
Calculated MW 26kDa
Observed MW 26kDa
Reactivity Human, Mouse
Tested applications WB
Recommended dilution WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HT-1080, Mouse thymus
Cellular location Membrane, Single-pass type II membrane protein
ABclonal:Western blot - 4-1BBL/CD137L Rabbit pAb (A10202) }

Western blot - 4-1BBL/CD137L Rabbit pAb (A10202)

Western blot analysis of extracts of various cell lines, using 4-1BBL/CD137L antibody (A10202) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
[ndnapps-contactform]