ABclonal

ADAM22 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ADAM22 Rabbit pAb
Catalog No. AB-A10030
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Unlike other members of the ADAM protein family, the protein encoded by this gene lacks metalloprotease activity since it has no zinc-binding motif. This gene is highly expressed in the brain and may function as an integrin ligand in the brain. In mice, it has been shown to be essential for correct myelination in the peripheral nervous system. Alternative splicing results in several transcript variants.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 223-400 of human ADAM22 (NP_004185.1).
Sequence SKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSG
Gene ID 53616
Swiss prot Q9P0K1
Synonyms ADAM22; ADAM 22; MDC2
Calculated MW 91kDa/95kDa/96kDa/100kDa
Observed MW 100kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:1000 - 1:4000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, Mouse brain, Mouse kidney, Mouse heart, Rat kidney, Rat heart
Cellular location Cell projection, Membrane, Single-pass type I membrane protein, axon
ABclonal:Western blot - ADAM22 Rabbit pAb (A10030) }

Western blot - ADAM22 Rabbit pAb (A10030)

Western blot analysis of extracts of various cell lines, using ADAM22 antibody (A10030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
[ndnapps-contactform]