ABclonal

ALKBH6 Rabbit pAb

  • Sale
  • €59,00
  • Regular price €101,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ALKBH6 Rabbit pAb
Catalog No. AB-A10004
Host species Rabbit
Purification method Affinity purification
Isotype IgG

 

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 97-266 of human ALKBH6 (NP_116267.3).
Sequence GMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK
Gene ID 84964
Swiss prot Q3KRA9
Synonyms ALKBH6; ABH6
Calculated MW 15kDa/26kDa/29kDa
Observed MW 26kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:200 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples K-562, Mouse brain, Mouse lung, Rat brain, Rat heart, Rat lung
Cellular location Cytoplasm, Nucleus
ABclonal:Western blot - ALKBH6 Rabbit pAb (A10004) }

Western blot - ALKBH6 Rabbit pAb (A10004)

Western blot analysis of extracts of various cell lines, using ALKBH6 antibody (A10004) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
[ndnapps-contactform]