ABclonal

ANGPT2 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name ANGPT2 Rabbit pAb
Catalog No. AB-A0698
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-496 of human ANGPT2 (NP_001138.1).
Sequence AMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Gene ID 285
Swiss prot O15123
Synonyms ANGPT2; AGPT2; ANG2
Calculated MW 50kDa/56kDa
Observed MW 75kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:500 - 1:2000
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-549, HT-29, HepG2, K-562, Raji, Mouse brain, Mouse spleen, Rat kidney, Rat heart
Cellular location Secreted
ABclonal:Western blot - ANGPT2 Rabbit pAb (A0698) }

Western blot - ANGPT2 Rabbit pAb (A0698)

Western blot analysis of extracts of various cell lines, using ANGPT2 antibody (A0698) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - ANGPT2 Rabbit pAb (A0698) }

Immunofluorescence - ANGPT2 Rabbit pAb (A0698)

Immunofluorescence analysis of HeLa cells using ANGPT2 antibody (A0698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
[ndnapps-contactform]