ABclonal

HDAC5 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene. 

Product name HDAC5 Rabbit pAb
Catalog No. AB-A0632
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Immunogen

Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human HDAC5 (NP_005465.2).
Sequence EETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLAT
Gene ID 10014
Swiss prot Q9UQL6
Synonyms HDAC5; HD5; NY-CO-9
Calculated MW 112kDa/121kDa/122kDa
Observed MW 132kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC IF
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SW620, Mouse brain, Mouse heart, Rat brain, Rat heart
Cellular location Cytoplasm, Nucleus

Product Images


ABclonal:Western blot - HDAC5 Rabbit pAb (A0632) }

Western blot - HDAC5 Rabbit pAb (A0632)

Western blot analysis of extracts of various cell lines, using HDAC5 antibody (A0632) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - HDAC5 Rabbit pAb (A0632) }

Immunohistochemistry - HDAC5 Rabbit pAb (A0632)

Immunohistochemistry of paraffin-embedded rat liver using HDAC5 antibody (A0632) at dilution of 1:100 (40x lens).
ABclonal:Immunohistochemistry - HDAC5 Rabbit pAb (A0632) }

Immunohistochemistry - HDAC5 Rabbit pAb (A0632)

Immunohistochemistry of paraffin-embedded human tonsil using HDAC5 antibody (A0632) at dilution of 1:100 (40x lens).
ABclonal:Immunohistochemistry - HDAC5 Rabbit pAb (A0632) }

Immunohistochemistry - HDAC5 Rabbit pAb (A0632)

Immunohistochemistry of paraffin-embedded mouse spinal cord using HDAC5 antibody (A0632) at dilution of 1:100 (40x lens).
ABclonal:Immunofluorescence - HDAC5 Rabbit pAb (A0632) }

Immunofluorescence - HDAC5 Rabbit pAb (A0632)

Immunofluorescence analysis of A-549 cells using HDAC5 antibody (A0632).

3

[ndnapps-contactform]