ABclonal

TGFBR3 Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Product name TGFBR3 Rabbit pAb
Catalog No. AB-A0627
Host species Rabbit
Purification method Affinity purification
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-340 of human TGFBR3 (NP_003234.2).
Sequence ANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPIT
Gene ID 7049
Swiss prot Q03167
Synonyms TGFBR3; BGCAN; betaglycan
Calculated MW 93kDa
Observed MW 110kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, Mouse brain, Mouse lung, Rat brain
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space
Customer validation

WB(Homo sapiens)

PMID: 33280236  Title: HELLS, a chromatin remodeler is highly expressed in pancreatic cancer and downregulation of it impairs tumor growth and sensitizes to cisplatin by reexpressing the tumor suppressor TGFBR3 
ABclonal:Western blot - TGFBR3 Rabbit pAb (A0627) }

Western blot - TGFBR3 Rabbit pAb (A0627)

Western blot analysis of extracts of various cell lines, using TGFBR3 antibody (A0627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
[ndnapps-contactform]