ABclonal

DYRK1A Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.

Product name DYRK1A Rabbit pAb
Catalog No. AB-A0595
Host species Rabbit
Purification method Affinity purification
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2).
Sequence LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Gene ID 1859
Swiss prot Q13627
Synonyms DYRK1A; DYRK; DYRK1; HP86; MNB; MNBH; MRD7
Calculated MW 60kDa/61kDa/66kDa/84kDa/85kDa
Observed MW 72kDa
Reactivity Human, Mouse, Rat
Tested applications WB
Recommended dilution WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples NCI-H460, 293T, K-562, HeLa, Jurkat, Mouse brain, Rat brain
Cellular location Nucleus speckle
Customer validation

WB(Homo sapiens,Glycyrrhiza uralensis Fisch)

PMID: 31838052  Title: Licocoumarone induces BxPC-3 pancreatic adenocarcinoma cell death by inhibiting DYRK1A 
ABclonal:Western blot - DYRK1A Rabbit pAb (A0595) }

Western blot - DYRK1A Rabbit pAb (A0595)

Western blot analysis of extracts of various cell lines, using DYRK1A antibody (A0595) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
[ndnapps-contactform]