ABclonal

Albumin Rabbit pAb

  • Sale
  • Regular price €188,00
Shipping calculated at checkout.

* Price changes reserved. Please refer to the price on the confirmation letter.


Product name Albumin Rabbit pAb
Catalog No. AB-A0353
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-255 of human Albumin (NP_000468.1).
Sequence GVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEV
Gene ID 213
Swiss prot P02768
Synonyms ALB; HSA; PRO0883; PRO0903; PRO1341; albumin; Albumin
Calculated MW 45kDa/47kDa/69kDa
Observed MW 69kDa
Reactivity Human, Mouse, Rat
Tested applications WB IHC IF
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:100
IF 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples NCI-H460, MCF7, Mouse liver, Mouse blood
Cellular location Secreted
Customer validation

WB(Mus musculus, Rattus norvegicus)

PMID: 28512230  Title: Differential Proteomic Analysis of Gender-dependent Hepatic Tumorigenesis in Hras12V Transgenic Mice  PMID: 28922406  Title: Loss of liver-specific and sexually dimorphic gene expression by aryl hydrocarbon receptor activation in C57BL/6 mice.  PMID: 30226536  Title: Bax inhibitor-1 suppresses early brain injury following experimental subarachnoid hemorrhage in rats 
ABclonal:Western blot - Albumin Rabbit pAb (A0353) }

Western blot - Albumin Rabbit pAb (A0353)

Western blot analysis of extracts of various cell lines, using Albumin antibody (A0353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunohistochemistry - Albumin Rabbit pAb (A0353) }

Immunohistochemistry - Albumin Rabbit pAb (A0353)

Immunohistochemistry of paraffin-embedded rat brain using Albumin antibody (A0353) at dilution of 1:100 (40x lens).
ABclonal:Immunohistochemistry - Albumin Rabbit pAb (A0353) }

Immunohistochemistry - Albumin Rabbit pAb (A0353)

Immunohistochemistry of paraffin-embedded mouse brain using Albumin antibody (A0353) at dilution of 1:100 (40x lens).
ABclonal:Immunofluorescence - Albumin Rabbit pAb (A0353) }

Immunofluorescence - Albumin Rabbit pAb (A0353)

Immunofluorescence analysis of rat liver using Albumin antibody (A0353) at dilution of 1:100. Blue: DAPI for nuclear staining.
[ndnapps-contactform]