Antibodies from our partner, ABclonal, is under seasonal promotion, valid until 30.06.2021.

     (1) Buy one 100 µL antibody and get a 20 µL for free! Place the order online and we will change the price accordingly.

     (2) Any antibody at 20 µL costs 59 € plus shipping fee. 

     

Antibody On Sale

Images: 1, Application:

NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric RelB-p50 and RelB-p52 complexes are transcriptional activators. RELB neither associates with DNA nor with RELA/p65 or REL. Stimulates promoter activity in the presence of NFKB2/p49. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer in a CRY1/CRY2 independent manner. Increased repression of the heterodimer is seen in the presence of NFKB2/p52. Is required for both T and B lymphocyte maturation and function (PubMed:26385063).

RELB Rabbit pAb
ABclonal
Sold Out
View
Images: 1, Application:
Product name Alkaline Phosphatase (ALPL) Rabbit mAb
Catalog No. AB-A0514
Host species Rabbit
Purification method Affinity purification
Isotype IgG

This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. [provided by RefSeq, Oct 2015]

Immunogen A synthesized peptide derived from human Alkaline Phosphatase (ALPL) (ALPL)
Sequence
Gene ID 249
Swiss prot P05186
Synonyms AP-TNAP; APTNAP; HOPS; TNAP; TNSALP
Calculated MW 57kDa
Observed MW 80KDa
Reactivity Human, Mouse, Rat
Tested applications WB IHC
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HepG2, U-87MG, Mouse liver, Mouse kidney, Rat liver
Cellular location Cell membrane, GPI-anchor, Lipid-anchor
Customer validation

WB(Mus musculus)

PMID: 32929652  Title: ATP-binding cassette g1 regulates osteogenesis via Wnt/β-catenin and AMPK signaling pathways 
ABclonal:Western blot - Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) }

Western blot - Alkaline Phosphatase (ALPL) Rabbit mAb (A0514)

Western blot analysis of extracts of various cell lines, using Alkaline Phosphatase (ALPL) (ALPL) Rabbit mAb (A0514) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) }

Immunohistochemistry - Alkaline Phosphatase (ALPL) Rabbit mAb (A0514)

Immunohistochemistry of paraffin-embedded human placenta using Alkaline Phosphatase (ALPL) (ALPL) Rabbit mAb (A0514) at dilution of 1:100 (40x lens).
Alkaline Phosphatase (ALPL) Rabbit mAb
ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.

CRKL Rabbit pAb
ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.

ABclonal
Sold Out
View
Images: 1, Application:
Product name MCM2 Rabbit pAb
Catalog No. AB-A1056
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 360-700 of human MCM2 (NP_004517.2).

Gene ID

4171

Swiss prot

P49736

Synonyms

MCM2; BM28; CCNL1; CDCL1; D3S3194; DFNA70; MITOTIN; cdc19

Calculated MW

101kDa

Observed MW

130kDa

Reactivity Human, Mouse
Tested applications WB IHC
Recommended dilution WB 1:500 - 1:2000
IHC 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SW480, SH-SY5Y, Raji, A-549, HeLa, HL-60, Mouse thymus
Cellular location Nucleus

ABclonal:Western blot - MCM2 Polyclonal Antibody (A1056) }

Western blot - MCM2 Polyclonal Antibody (A1056)

Western blot analysis of extracts of various cell lines, using MCM2 antibody (A1056) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MCM2 Polyclonal Antibody (A1056) }

Immunohistochemistry - MCM2 Polyclonal Antibody (A1056)

Immunohistochemistry of paraffin-embedded human colon using MCM2 antibody (A1056) at dilution of 1:200 (40x lens).
MCM2 Rabbit pAb
ABclonal
On sale from €59
View
Images: 1, Application:

The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms.

BTK Mouse mAb
ABclonal
From €192
View
Images: 1, Application:

This gene encodes a membrane protein that is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The encoded kinase phosphorylates STAT proteins (signal transducers and activators of transcription) and plays a key role in interferon-alpha/beta and interferon-gamma signal transduction. Alternative splicing results in multiple transcript variants.

ABclonal
Sold Out
View
Images: 1, Application:

The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene.

ABclonal
Sold Out
View
Images: 1, Application:

This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.

ABclonal
Sold Out
View
Images: 1, Application:

The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.

ABclonal
Sold Out
View
Images: 1, Application:

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. Alternative splicing results in multiple transcript variants encoding different isoforms.

ABclonal
Sold Out
View
Images: 1, Application:

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Expression of this gene is up-regulated in some types of cancer. Multiple alternatively spliced variants, encoding the same protein, have been identified.

ABclonal
Sold Out
View
Images: 1, Application:

The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene.

ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

ABclonal
Sold Out
View
Images: 1, Application:
Product name ANGPT2 Rabbit pAb
Catalog No. AB-A0698
Host species Rabbit
Purification method Affinity purification
Isotype IgG

The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-496 of human ANGPT2 (NP_001138.1).
Sequence AMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Gene ID 285
Swiss prot O15123
Synonyms ANGPT2; AGPT2; ANG2
Calculated MW 50kDa/56kDa
Observed MW 75kDa
Reactivity Human, Mouse, Rat
Tested applications WB IF
Recommended dilution WB 1:500 - 1:2000
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-549, HT-29, HepG2, K-562, Raji, Mouse brain, Mouse spleen, Rat kidney, Rat heart
Cellular location Secreted
ABclonal:Western blot - ANGPT2 Rabbit pAb (A0698) }

Western blot - ANGPT2 Rabbit pAb (A0698)

Western blot analysis of extracts of various cell lines, using ANGPT2 antibody (A0698) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - ANGPT2 Rabbit pAb (A0698) }

Immunofluorescence - ANGPT2 Rabbit pAb (A0698)

Immunofluorescence analysis of HeLa cells using ANGPT2 antibody (A0698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone, kidney and brown adipose tissue development. Additionally, this protein induces ectopic bone formation and may promote fracture healing in human patients.

ABclonal
Sold Out
View
Images: 1, Application:

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants.

ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers.

ABclonal
Sold Out
View
Images: 1, Application:

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development.

ABclonal
Sold Out
View
Images: 1, Application:

Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma.

ABclonal
Sold Out
View
[ndnapps-contactform]